PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0299s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 304aa    MW: 33836.5 Da    PI: 8.5494
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0299s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.83.8e-3643100360
                  zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                             +++lkcprC+stntkfCyynny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr++++ 
  SapurV1A.0299s0040.1.p  43 SESLKCPRCESTNTKFCYYNNYNKSQPRHFCKTCKRHWTKGGSLRNVPVGGGRKNKRP 100
                             5789***********************************************9877665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-233599IPR003851Zinc finger, Dof-type
PfamPF027013.7E-314598IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.50346100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MGLSSKQVTS NGLDWSQTLL QERTLELPKP AGIRRQQQQN LQSESLKCPR CESTNTKFCY  60
YNNYNKSQPR HFCKTCKRHW TKGGSLRNVP VGGGRKNKRP KTSKSSASNT TSTNTASTAV  120
PRSNDRNNMI NRVNPQLPIQ SQQQKQNLPD LVLGDQKNLS EILDQAITNP PSSVLQQNSI  180
SCSNLDTKSF STNNNGVLLC SSLSLPQNQG LLFPYSSSFD THPSSICTSS FQPSNVYNYA  240
GEYMEDSTIT TIMPSTSSTI THPWQVPNTS SGMDMANYWN WDDIENYVST DLNVTWDDSE  300
IKP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027896.11e-177PREDICTED: dof zinc finger protein DOF4.6-like
RefseqXP_011027898.11e-177PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLB9H2631e-173B9H263_POPTR; Dof-type zinc finger domain-containing family protein
STRINGPOPTR_0004s03900.11e-173(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-29DNA binding with one finger 2.4